PE000280

From GPTWiki
Jump to navigation Jump to search
Name R.TEVSSNHVLIYLDKVSN[H5N4]QTLSLFFTVLQDVPVR.D
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H5N4 (N17)
Mod(s)
Molecular Weight 5401.596
Norm. RT
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00292887.7001,077.7255OrbitrapHuman Serum4