PE000271

From GPTWiki
Jump to navigation Jump to search
Name R.SDHGSSISCQPPAEIPGYLPADTVHLAVEFFN[H6N5S3]LTHLPANLLQGASK.L
Sequence SDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASK
Glycans(s) H6N5S3 (N32)
Mod(s) 57.021 (C9)
Molecular Weight 7777.444
Norm. RT
Protein LRG1 (P02750)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00028783.81883.7111,294.2496OrbitrapHuman Serum4