PE000268

From GPTWiki
Jump to navigation Jump to search
Name R.TEVSSNHVLIYLDKVSN[H5N4S2]QTLSLFFTVLQDVPVRDLKPAIVK.V
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4S2 (N17)
Mod(s)
Molecular Weight 6848.330
Norm. RT
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00029981.42281.3941,139.3946OrbitrapHuman Serum13
TG00295289.5111,367.0725OrbitrapHuman Serum8