PE000263

From GPTWiki
Jump to navigation Jump to search
Name K.NLASRPYTFHSHGITYYKEHEGAIYPDN[H5N4S2]TTDFQR.A
Sequence NLASRPYTFHSHGITYYKEHEGAIYPDNTTDFQR
Glycans(s) H5N4S2 (N28)
Mod(s)
Molecular Weight 6250.671
Norm. RT 37.886
Protein CP (P00450)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00533344.23244.57137.4501,039.7856OrbitrapHuman Serum13
TG00541844.86044.65638.3211,039.7856OrbitrapHuman Serum14
TG00539944.86044.78438.6251,247.5405OrbitrapHuman Serum13
TG00533644.23244.47037.2081,247.5405OrbitrapHuman Serum14