PE000260

From GPTWiki
Jump to navigation Jump to search
Name K.YLGN[H6N5S3]ATAIFFLPDEGKLQHLENELTHDIITK.F
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H6N5S3 (N4)
Mod(s)
Molecular Weight 6418.841
Norm. RT 160.343
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00024271.73871.8331,281.1745OrbitrapHuman Serum10
TG00271975.25975.195160.0891,281.1745OrbitrapHuman Serum13
TG00070475.53275.444160.3431,281.1745OrbitrapHuman Serum15
TG00520976.20975.827160.8171,281.1745OrbitrapHuman Serum15