PE000253

From GPTWiki
Jump to navigation Jump to search
Name K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H6N5S3]TTLTEILK.G
Sequence QLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILK
Glycans(s) H6N5S3 (N31)
Mod(s)
Molecular Weight 7042.372
Norm. RT
Protein SERPINA3 (P01011)

Samples

DDA Transition Groups