PE000249

From GPTWiki
Jump to navigation Jump to search
Name R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S]YSCSYR.T
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S (N27)
Mod(s) 57.021 (C30)
Molecular Weight 5767.357
Norm. RT 75.690
Protein A1BG (P04217)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00370345.60345.61978.2371,150.8805OrbitrapHuman Serum7
TG00029839.21639.1481,438.3484OrbitrapHuman Serum9
TG00131542.48342.47575.5011,150.8805OrbitrapHuman Serum8
TG00105142.23542.23075.5921,438.3484OrbitrapHuman Serum4
TG00312744.25944.44277.0371,150.8805OrbitrapHuman Serum8
TG00377845.60345.61778.2321,438.3484OrbitrapHuman Serum7
TG00103342.23542.26875.6901,150.8805OrbitrapHuman Serum8
TG00035739.21639.1831,150.8805OrbitrapHuman Serum7
TG00131342.48342.47675.5041,438.3484OrbitrapHuman Serum6
TG00196442.26842.36975.8721,150.8805OrbitrapHuman Serum8
TG00316144.25944.41076.9541,438.3484OrbitrapHuman Serum5
TG00198642.26842.35075.8241,438.3484OrbitrapHuman Serum9
TG00211041.89742.23774.1231,438.3484OrbitrapHuman Serum11

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG00853637.15137.15186.5621,150.8805TripleTOFHuman Serum40,389
TG00944537.65737.65788.4111,150.8805TripleTOFHuman Serum33,456.9
TG00914636.50636.50685.8441,150.8805TripleTOFHuman Serum33,075.3
TG00822936.57936.57983.0191,150.8805TripleTOFHuman Serum31,151.8
TG00983736.26036.26082.6381,150.8805TripleTOFHuman Serum10,812.8
TG00450034.30634.30685.3511,150.8805TripleTOFHuman Serum205.02