PE000247

From GPTWiki
Jump to navigation Jump to search
Name K.YLGN[H5N4S2]ATAIFFLPDEGKLQHLENELTHDIITK.F
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5762.613
Norm. RT 146.229
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00505965.04558.246113.4341,149.9285OrbitrapHuman Serum13
TG00046369.98769.708146.0351,149.9285OrbitrapHuman Serum8
TG00079271.51570.137146.868958.4426OrbitrapHuman Serum12
TG00079970.15270.069145.8471,149.9285OrbitrapHuman Serum9
TG00514965.04558.240113.4181,437.1584OrbitrapHuman Serum8
TG00549285.47585.336134.898958.4426OrbitrapHuman Serum14
TG00077971.51570.083146.7311,149.9285OrbitrapHuman Serum8
TG00084870.15270.084145.8841,437.1584OrbitrapHuman Serum13
TG00486273.32973.470134.0021,149.9285OrbitrapHuman Serum12
TG00271670.94069.713146.1921,149.9285OrbitrapHuman Serum10
TG00099869.77070.159148.1601,437.1584OrbitrapHuman Serum8
TG00523479.18374.859110.0591,149.9285OrbitrapHuman Serum14
TG00031766.41665.8681,437.1584OrbitrapHuman Serum10
TG00267970.94069.742146.2661,437.1584OrbitrapHuman Serum11
TG00112069.77070.150148.1361,149.9285OrbitrapHuman Serum10
TG00532579.18383.782131.449958.4426OrbitrapHuman Serum14
TG00033466.41665.869821.6657OrbitrapHuman Serum10
TG00496772.50972.677132.9941,149.9285OrbitrapHuman Serum12
TG00027169.98769.670145.9381,437.1584OrbitrapHuman Serum12
TG00027366.41665.8711,149.9285OrbitrapHuman Serum8

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG01001852.70652.706158.4551,149.9285TripleTOFHuman Serum2,721,930
TG00958752.47652.476161.6281,149.9285TripleTOFHuman Serum2,387,580
TG01045254.59554.595167.0571,149.9285TripleTOFHuman Serum2,107,970
TG01037552.69752.697158.409958.4426TripleTOFHuman Serum1,008,570
TG00992852.47552.475161.625958.4426TripleTOFHuman Serum989,253
TG01075754.59254.592167.044958.4426TripleTOFHuman Serum726,164
TG01033352.69352.693158.3951,437.1584TripleTOFHuman Serum718,019
TG00988452.44452.444161.4741,437.1584TripleTOFHuman Serum587,484
TG00805452.90652.906154.1321,149.9285TripleTOFHuman Serum524,781
TG01078353.79053.790163.5641,149.9285TripleTOFHuman Serum479,866
TG00825952.88052.880154.0171,437.1584TripleTOFHuman Serum442,240
TG01078252.66652.666161.1941,437.1584TripleTOFHuman Serum432,110
TG01078653.79553.795163.5891,437.1584TripleTOFHuman Serum336,486
TG00997652.68552.685158.358821.6657TripleTOFHuman Serum261,698
TG01071854.57454.574166.9631,437.1584TripleTOFHuman Serum204,284
TG00674553.03453.034157.4201,149.9285TripleTOFHuman Serum145,588
TG00722052.96852.968157.8091,149.9285TripleTOFHuman Serum133,763
TG00750252.98052.980164.8261,149.9285TripleTOFHuman Serum121,901
TG00777552.89752.897157.5741,149.9285TripleTOFHuman Serum115,957
TG00895153.35453.354164.4001,149.9285TripleTOFHuman Serum73,428.5
TG00743852.96252.962157.783958.4426TripleTOFHuman Serum31,913
TG00799952.89252.892157.549958.4426TripleTOFHuman Serum28,601.5
TG01077954.99454.994175.4631,149.9285TripleTOFHuman Serum28,444.3