PE000246

From GPTWiki
Jump to navigation Jump to search
Name R.LSLHRPALEDLLLGSEAN[H5N4S]LTCTLTGLRDASGVTFTWTPSSGK.S
Sequence LSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGK
Glycans(s) H5N4S (N18)
Mod(s) 57.021 (C21)
Molecular Weight 6415.989
Norm. RT
Protein IGHA1 (P01876)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00024663.87963.7611,280.6065OrbitrapHuman Serum9