PE000243

From GPTWiki
Jump to navigation Jump to search
Name K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H5N4S2]TTLTEILK.G
Sequence QLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILK
Glycans(s) H5N4S2 (N31)
Mod(s)
Molecular Weight 6386.144
Norm. RT
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00036974.96474.928910.7417OrbitrapHuman Serum9
TG00030474.96474.9221,062.3636OrbitrapHuman Serum11
TG00028374.96474.9321,274.6355OrbitrapHuman Serum9