PE000239

From GPTWiki
Jump to navigation Jump to search
Name R.TEVSSNHVLIYLDKVSN[H5N4FS2]QTLSLFFTVLQDVPVRDLKPAIVK.V
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4FS2 (N17)
Mod(s)
Molecular Weight 6994.388
Norm. RT
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00031681.54881.4011,163.7376OrbitrapHuman Serum19