PE000234

From GPTWiki
Jump to navigation Jump to search
Name K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H5N4FS2]TTLTEILK.G
Sequence QLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILK
Glycans(s) H5N4FS2 (N31)
Mod(s)
Molecular Weight 6532.202
Norm. RT
Protein SERPINA3 (P01011)

Samples

DDA Transition Groups