PE000232

From GPTWiki
Jump to navigation Jump to search
Name K.SLGNVN[H5N4S]FTVSAEALESQELCGTEVPSVPEHGRK.D
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H5N4S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5472.403
Norm. RT 73.340
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00031938.92738.9691,364.6094OrbitrapHuman Serum7
TG00529459.67359.54273.3401,364.6094OrbitrapHuman Serum7