PE000229

From GPTWiki
Jump to navigation Jump to search
Name R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6214.554
Norm. RT 74.694
Protein A1BG (P04217)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00135842.06742.19574.8091,550.1474OrbitrapHuman Serum6
TG00034939.04339.0951,550.1474OrbitrapHuman Serum9
TG00522959.99460.10674.6921,550.1474OrbitrapHuman Serum5
TG00518843.10243.14572.7351,240.3195OrbitrapHuman Serum11
TG00126942.06742.12174.6261,240.3195OrbitrapHuman Serum9
TG00096141.88041.87674.6721,240.3195OrbitrapHuman Serum8
TG00372945.13144.98676.6061,240.3195OrbitrapHuman Serum8
TG00024539.04339.0591,240.3195OrbitrapHuman Serum6
TG00190442.15642.09575.1821,550.1474OrbitrapHuman Serum8
TG00534459.99460.10774.6941,240.3195OrbitrapHuman Serum9
TG00175542.15642.04375.0511,240.3195OrbitrapHuman Serum13

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG00810136.05636.05680.7401,240.3195TripleTOFHuman Serum100,631
TG00840136.69636.69684.2951,240.3195TripleTOFHuman Serum69,387.7
TG00932237.15037.15086.0501,240.3195TripleTOFHuman Serum67,452.1
TG00900636.00936.00983.5281,240.3195TripleTOFHuman Serum67,303
TG00870336.82336.82382.9321,240.3195TripleTOFHuman Serum66,943.2
TG00966035.83135.83180.5491,240.3195TripleTOFHuman Serum30,118.5
TG00449933.86933.86983.1251,240.3195TripleTOFHuman Serum122.796