PE000226

From GPTWiki
Jump to navigation Jump to search
Name R.TEVSSNHVLIYLDKVSN[H5N4FS2]QTLSLFFTVLQDVPVR.D
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H5N4FS2 (N17)
Mod(s)
Molecular Weight 6129.845
Norm. RT
Protein A2M (P01023)

Samples

DDA Transition Groups