PE000224

From GPTWiki
Jump to navigation Jump to search
Name R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 6058.453
Norm. RT 85.712
Protein A1BG (P04217)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00133546.94946.43185.2821,209.0995OrbitrapHuman Serum8
TG00526265.67965.75288.2271,209.0995OrbitrapHuman Serum9
TG00125946.55446.52787.0361,209.0995OrbitrapHuman Serum8
TG00368748.56648.76086.3301,511.1214OrbitrapHuman Serum11
TG00305547.98847.79485.7121,007.7506OrbitrapHuman Serum7
TG00149146.63046.44086.1151,209.0995OrbitrapHuman Serum8
TG00547564.35064.12384.5371,209.0995OrbitrapHuman Serum7
TG00032244.12744.0391,511.1214OrbitrapHuman Serum7
TG00132946.94946.41385.2381,511.1214OrbitrapHuman Serum14
TG00536164.35064.12484.5391,511.1214OrbitrapHuman Serum9
TG00122546.55446.53887.0641,511.1214OrbitrapHuman Serum13
TG00030244.12744.0731,209.0995OrbitrapHuman Serum8
TG00316747.98847.74685.5881,511.1214OrbitrapHuman Serum9
TG00318847.98847.79685.7171,209.0995OrbitrapHuman Serum7
TG00508747.48347.67784.9491,209.0995OrbitrapHuman Serum5
TG00504050.90151.10181.9111,511.1214OrbitrapHuman Serum9
TG00366248.56648.74786.2971,209.0995OrbitrapHuman Serum7

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG00843237.97537.97590.6661,209.0995TripleTOFHuman Serum309,891
TG00812837.54537.54587.2271,209.0995TripleTOFHuman Serum303,403
TG00873238.05038.05088.9681,209.0995TripleTOFHuman Serum277,118
TG00903737.33537.33589.7121,209.0995TripleTOFHuman Serum272,059
TG00934738.29038.29091.3611,209.0995TripleTOFHuman Serum270,233
TG00969737.39137.39188.1481,209.0995TripleTOFHuman Serum71,655.5
TG01055338.10838.10890.6071,209.0995TripleTOFHuman Serum66,199.6
TG00845237.97337.97390.6571,007.7506TripleTOFHuman Serum57,349.4
TG00814537.54137.54187.2091,007.7506TripleTOFHuman Serum54,679.4
TG00905937.33037.33089.6881,007.7506TripleTOFHuman Serum41,721.8
TG00449634.97434.97488.7461,209.0995TripleTOFHuman Serum299.089
TG00649734.94434.94488.5941,007.7506TripleTOFHuman Serum118.5