PE000189

From GPTWiki
Jump to navigation Jump to search
Name K.NCGVN[H5N4S2]CSGDVFTALIGEIASPNYPKPYPENSR.C
Sequence NCGVNCSGDVFTALIGEIASPNYPKPYPENSR
Glycans(s) H5N4S2 (N5)
Mod(s) 57.021 (C2), 57.021 (C6)
Molecular Weight 5748.412
Norm. RT 140.766
Protein C1S (P09871)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00271467.51167.647140.9551,147.0935OrbitrapHuman Serum9
TG00070967.75267.679140.6271,147.0935OrbitrapHuman Serum7
TG00275067.51167.627140.9041,433.6154OrbitrapHuman Serum7
TG00333669.08468.824140.3691,147.0935OrbitrapHuman Serum4
TG00105467.87967.633141.5971,433.6154OrbitrapHuman Serum8
TG00075667.75267.654140.5631,433.6154OrbitrapHuman Serum7

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG00554546.21646.216143.3681,147.0935TripleTOFHuman Serum132.889
TG00554446.19246.192143.2331,433.6154TripleTOFHuman Serum80.605