PE000162

From GPTWiki
Jump to navigation Jump to search
Name K.IQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFN[H6N5S3]CSESFTMIGHR.S
Sequence IQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHR
Glycans(s) H6N5S3 (N48)
Mod(s) 57.021 (C3), 57.021 (C14), 57.021 (C21), 57.021 (C49)
Molecular Weight 9731.028
Norm. RT
Protein CFH (P08603)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00039784.55584.7961,619.8526OrbitrapHuman Serum4