PE000148

From GPTWiki
Jump to navigation Jump to search
Name S.LGNVN[H5N4FS2]FTVSAEALESQELCGTEVPSVPEHGRK.D
Sequence LGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H5N4FS2 (N5)
Mod(s) 57.021 (C19)
Molecular Weight 5822.524
Norm. RT
Protein A2M (P01023)

Samples

DDA Transition Groups