PE000146

From GPTWiki
Jump to navigation Jump to search
Name N.YYSN[H5N4S]ATTDEHGLVQFSINTTNVM[Ox]GTSLTVR.V
Sequence YYSNATTDEHGLVQFSINTTNVMGTSLTVR
Glycans(s) H5N4S (N4)
Mod(s) 15.995 (M23)
Molecular Weight 5266.265
Norm. RT
Protein A2M (P01023)

Samples

DDA Transition Groups