PE000134

From GPTWiki
Jump to navigation Jump to search
Name R.FSLLGHASISCTVEN[H5N4S2]ETIGVWRPSPPTCEK.I
Sequence FSLLGHASISCTVENETIGVWRPSPPTCEK
Glycans(s) H5N4S2 (N15)
Mod(s) 57.021 (C11), 57.021 (C28)
Molecular Weight 5594.411
Norm. RT 95.172
Protein C4BPA (P04003)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00082849.87649.75294.5051,395.1144OrbitrapHuman Serum13
TG00026349.43349.68794.9271,116.2935OrbitrapHuman Serum6
TG00063149.43349.48294.4041,395.1144OrbitrapHuman Serum11
TG00085349.87650.24295.7431,116.2935OrbitrapHuman Serum11
TG00339651.71951.58695.3761,395.1144OrbitrapHuman Serum11
TG00071450.10749.96195.6401,395.1144OrbitrapHuman Serum11
TG00267549.70349.87595.9041,116.2935OrbitrapHuman Serum7
TG00072050.10750.49196.9861,116.2935OrbitrapHuman Serum10
TG00525567.23067.24491.8031,395.1144OrbitrapHuman Serum8
TG00089049.98649.91695.1021,395.1144OrbitrapHuman Serum14
TG00343351.71951.53595.2431,116.2935OrbitrapHuman Serum7
TG00517749.58749.60490.1431,116.2935OrbitrapHuman Serum12
TG00100149.32149.56794.9761,395.1144OrbitrapHuman Serum13
TG00276749.70349.66395.3661,395.1144OrbitrapHuman Serum12

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG00553837.67337.67396.7001,116.2935TripleTOFHuman Serum301.978
TG00553737.67737.67796.7201,395.1144TripleTOFHuman Serum181.836