PE000130

From GPTWiki
Jump to navigation Jump to search
Name R.FSLLGHASISCTVEN[H5N4FS]ETIGVWRPSPPTCEK.I
Sequence FSLLGHASISCTVENETIGVWRPSPPTCEK
Glycans(s) H5N4FS (N15)
Mod(s) 57.021 (C11), 57.021 (C28)
Molecular Weight 5449.373
Norm. RT
Protein C4BPA (P04003)

Samples

DDA Transition Groups