PE000104

From GPTWiki
Jump to navigation Jump to search
Name A.NYYSN[H5N4F]ATTDEHGLVQFSINTTNVM[Ox]GTSLTVR.V
Sequence NYYSNATTDEHGLVQFSINTTNVMGTSLTVR
Glycans(s) H5N4F (N5)
Mod(s) 15.995 (M24)
Molecular Weight 5235.271
Norm. RT
Protein A2M (P01023)

Samples

DDA Transition Groups