PE000095

From GPTWiki
Jump to navigation Jump to search
Name R.FSLLGHASISCTVEN[H5N4FS2]ETIGVWRPSPPTCEK.I
Sequence FSLLGHASISCTVENETIGVWRPSPPTCEK
Glycans(s) H5N4FS2 (N15)
Mod(s) 57.021 (C11), 57.021 (C28)
Molecular Weight 5740.469
Norm. RT 96.313
Protein C4BPA (P04003)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00070350.11950.22696.3131,431.6294OrbitrapHuman Serum10
TG00334351.94252.71898.3301,431.6294OrbitrapHuman Serum9
TG00078050.11950.19296.2271,145.5045OrbitrapHuman Serum13