PE000094

From GPTWiki
Jump to navigation Jump to search
Name R.FQSPAGTEALFELHNISVADSAN[H5N4S2]YSCVYVDLKPPFGGSAPSER.L
Sequence FQSPAGTEALFELHNISVADSANYSCVYVDLKPPFGGSAPSER
Glycans(s) H5N4S2 (N23)
Mod(s) 57.021 (C26)
Molecular Weight 6849.980
Norm. RT 128.130
Protein A1BG (P04217)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00272162.73062.671128.3411,709.0034OrbitrapHuman Serum6
TG00069662.71962.855128.3791,367.4045OrbitrapHuman Serum9
TG00270062.73062.504127.9181,367.4045OrbitrapHuman Serum8
TG00334863.97163.929127.5931,367.4045OrbitrapHuman Serum7