PE000082

From GPTWiki
Jump to navigation Jump to search
Name K.YTGN[H6N5FS3]ASALFILPDQDKMEEVEAMLLPETLKR.W
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5FS3 (N4)
Mod(s)
Molecular Weight 6546.847
Norm. RT 167.466
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00268977.92978.127167.5221,306.7755OrbitrapHuman Serum14
TG00078978.22578.252167.4721,633.2174OrbitrapHuman Serum15
TG00073778.22578.224167.4011,306.7755OrbitrapHuman Serum12
TG00067778.50978.330167.4611,306.7755OrbitrapHuman Serum19