PE000081

From GPTWiki
Jump to navigation Jump to search
Name K.YTGN[H6N5S3]ASALFILPDQDKMEEVEAMLLPETLKR.W
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5S3 (N4)
Mod(s)
Molecular Weight 6400.789
Norm. RT 167.839
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00065878.51478.472167.8211,277.5645OrbitrapHuman Serum11
TG00065078.51478.479167.8391,596.7024OrbitrapHuman Serum10
TG00517079.39679.324170.2411,277.5645OrbitrapHuman Serum12

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG00871154.73654.736171.0741,277.5645TripleTOFHuman Serum97,011.2
TG00810954.02954.029159.0241,277.5645TripleTOFHuman Serum95,778.2
TG00932854.84554.845168.4821,277.5645TripleTOFHuman Serum69,981.3