PE000080

From GPTWiki
Jump to navigation Jump to search
Name K.YTGN[H6N5FS3]ASALFILPDQDKMEEVEAMLLPETLK.R
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H6N5FS3 (N4)
Mod(s)
Molecular Weight 6390.746
Norm. RT 191.456
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00062487.80987.532190.7681,594.1924OrbitrapHuman Serum9
TG00270487.77487.613191.5681,594.1924OrbitrapHuman Serum9
TG00062787.80987.759191.3431,275.5555OrbitrapHuman Serum6
TG00263587.55487.976193.3451,594.1924OrbitrapHuman Serum9