PE000079

From GPTWiki
Jump to navigation Jump to search
Name K.YTGN[H6N5S3]ASALFILPDQDKMEEVEAMLLPETLK.R
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H6N5S3 (N4)
Mod(s)
Molecular Weight 6244.688
Norm. RT 192.930
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00514289.9521,246.3435OrbitrapHuman Serum8
TG00271287.61787.982192.5041,557.6774OrbitrapHuman Serum8
TG00062287.8771,557.6774OrbitrapHuman Serum8
TG00262088.30987.980193.3561,557.6774OrbitrapHuman Serum8