PE000073

From GPTWiki
Jump to navigation Jump to search
Name K.YLGN[H6N5FS3]ATAIFFLPDEGKLQHLENELTHDIITK.F
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H6N5FS3 (N4)
Mod(s)
Molecular Weight 6564.899
Norm. RT 159.754
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00272475.05375.063159.7541,310.3855OrbitrapHuman Serum17
TG00078475.24375.376160.1701,310.3855OrbitrapHuman Serum16
TG00068875.32675.250159.6601,310.3855OrbitrapHuman Serum20