PE000059

From GPTWiki
Jump to navigation Jump to search
Name R.VIDFN[H5N4S2]CTTSSVSSALANTKDSPVLIDFFEDTER.Y
Sequence VIDFNCTTSSVSSALANTKDSPVLIDFFEDTER
Glycans(s) H5N4S2 (N5)
Mod(s) 57.021 (C6)
Molecular Weight 5900.524
Norm. RT 158.640
Protein HRG (P04196)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00060772.15774.847158.6401,471.6394OrbitrapHuman Serum8