PE000028

From GPTWiki
Jump to navigation Jump to search
Name K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4FS2]GSLFAFR.G
Sequence GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFR
Glycans(s) H5N4FS2 (N62)
Mod(s) 57.021 (C49)
Molecular Weight 9833.505
Norm. RT
Protein VTN (P04004)

Samples

DDA Transition Groups