P08603@N718

From GPTWiki
Jump to navigation Jump to search
Protein CFH (P08603)
Site N718
GlyGen P08603@N718

Samples (Peptides)

Human Serum (1 / 1)

Peptides

 StartPeptideEndGlycanMol. Wt.Trans. GroupsDIA Trans. Groups
PE000162671K.IQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFN[H6N5S3]CSESFTMIGHR.S729H6N5S39,731.02810