P04196@N125

From GPTWiki
Jump to navigation Jump to search
Protein HRG (P04196)
Site N125
GlyGen P04196@N125

Samples (Peptides)

Human Serum (5 / 5)

Peptides

 StartPeptideEndGlycanMol. Wt.Trans. GroupsDIA Trans. Groups
PE000993121R.VIDFN[H5N3S]CTTSSVSSALANTK.D139H5N3S3,742.57610
PE000319121R.VIDFN[H5N4]CTTSSVSSALANTK.D139H5N43,654.56010
PE000215121R.VIDFN[H5N4S]CTTSSVSSALANTK.D139H5N4S3,945.6552113
PE000059121R.VIDFN[H5N4S2]CTTSSVSSALANTKDSPVLIDFFEDTER.Y153H5N4S25,900.52410
PE000058121R.VIDFN[H5N4S2]CTTSSVSSALANTK.D139H5N4S24,236.7511914