P04004@N169

From GPTWiki
Jump to navigation Jump to search
Protein VTN (P04004)
Site N169
GlyGen P04004@N169

Samples (Peptides)

Human Serum (9 / 9)

Peptides

 StartPeptideEndGlycanMol. Wt.Trans. GroupsDIA Trans. Groups
PE001474169K.N[H5N3S]GSLFAFR.G176H5N3S2,639.07410
PE001225108K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N3S]GSLFAFR.G176H5N3S9,193.27210
PE000225108K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S]GSLFAFR.G176H5N4S9,396.35130
PE000530169K.N[H5N4S]GSLFAFR.G176H5N4S2,842.15410
PE000196139R.PETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S2]GSLFAFR.G176H5N4S26,477.86320
PE000651169K.N[H5N4S2]GSLFAFR.G176H5N4S23,133.2491310
PE000256108K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S2]GSLFAFR.G176H5N4S29,687.44710
PE001242147R.PQPPAEEELCSGKPFDAFTDLKN[H5N4S2]GSLFAFR.G176H5N4S25,590.40120
PE001473169K.N[H6N3S]GSLFAFR.G176H6N3S2,801.12710