G80735OA

From GPTWiki
Jump to navigation Jump to search

Name(s) H6N6F
HexNAc(6)Hex(6)Fuc(1)
HexNAc(6)Hex(6)dHex(1)
Molecular Weight 2354.8616492
Class(es) N-Glycan
GlyGen

G80735OA

GNOme

G80735OA

Topologies

Samples (Peptides)

Human Serum (1 / 4), SARS-CoV-2 Spike Protein (3 / 4)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001166K.CGLVPVLAENYN[H6N6F]KSDNCEDTPEAGYFAIAVVK.K5,897.531P02787N43210
PE001628K.TQSLLIVNN[H6N6F]ATNVVIK.V4,080.861P0DTC2N12210
PE001552K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6F]FTTAPAICHDGK.A6,906.087P0DTC2N107420
PE001532R.EGVFVSN[H6N6F]GTHWFVTQR.N4,217.768P0DTC2N109820