G68318VE

From GPTWiki
Jump to navigation Jump to search

Name(s) H4N5F
HexNAc(5)Hex(4)Fuc(1)
HexNAc(5)Hex(4)dHex(1)
Molecular Weight 1827.6766298
Class(es) N-Glycan
GlyGen

G68318VE

GNOme

G68318VE

Topologies

Samples (Peptides)

HEK293 Cells (2 / 21), Human ACE2 Protein (5 / 21), Human Serum (7 / 21), NIST IgG Standard (2 / 21), SARS-CoV-2 Spike Protein (6 / 21)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001417R.EEQYN[H4N5F]STYRVVSVLTVLHQDWLNGKEYK.C5,225.371P01857N18010
PE000955K.TKPREEQYN[H4N5F]STYR.V3,498.478P01857N180140
PE000944R.EEQYN[H4N5F]STYR.V3,016.181P01857N180100
PE001445R.EEQFN[H4N5F]STFR.V2,984.192P01859N17674
PE001093K.TKPREEQFN[H4N5F]STYR.V3,482.483P01861N17710
PE001437R.EEQFN[H4N5F]STYR.V3,000.186P01861N17732
PE001079R.LSLHRPALEDLLLGSEAN[H4N5F]LTCTLTGLR.D4,790.268P01876N14441
PE001079R.LSLHRPALEDLLLGSEAN[H4N5F]LTCTLTGLR.D4,790.268P01877N13141
PE001149K.TPLTAN[H4N5F]ITK.S2,785.226P01877N20520
PE001575K.TQSLLIVNN[H4N5F]ATNVVIK.V3,553.676P0DTC2N12220
PE001584K.VCEFQFCNDPFLGVYYHKNN[H4N5F]K.S4,505.881P0DTC2N14920
PE001489K.DFGGFN[H4N5F]FSQILPDPSKPSKR.S4,063.804P0DTC2N80120
PE001562K.TPPIKDFGGFN[H4N5F]FSQILPDPSKPSK.R4,444.035P0DTC2N80130
PE001550K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N5F]FTTAPAICHDGK.A6,378.902P0DTC2N107440
PE001528R.EGVFVSN[H4N5F]GTHWFVTQR.N3,690.583P0DTC2N109820
PE002055R.DLQGNPIAN[H4N5F]ATISVEGIDHDVTSAK.D4,391.948P16870N39010
PE002190R.LSAVNSIFLSHN[H4N5F]NTK.E3,471.540P48960N45310
PE001765K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N5F]ITEENVQNMNNAGDKWSAFLK.E7,471.272Q9BYF1N5310
PE001706K.LQLQALQQN[H4N5F]GSSVLSEDK.S3,784.688Q9BYF1N10330
PE001726K.LQLQALQQN[H4N5F]GSSVLSEDKSK.R3,999.815Q9BYF1N10320
PE001738K.LQLQALQQN[H4N5F]GSSVLSEDKSKR.L4,155.916Q9BYF1N10310
PE001752K.SIGLLSPDFQEDN[H4N5F]ETEINFLLK.Q4,348.935Q9BYF1N43210