G37818NZ

From GPTWiki
Jump to navigation Jump to search

Name(s) H7N6S2
A4G4S2
HexNAc(6)Hex(7)NeuAc(2)
Molecular Weight 2953.0473968
Class(es) N-Glycan
GlyGen

G37818NZ

GNOme

G37818NZ

Topologies

Samples (Peptides)

Human Serum (4 / 5), SARS-CoV-2 Spike Protein (1 / 5)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001097K.VVLHPN[H7N6S2]YSQVDIGLIK.L4,747.051P00738N24110
PE001039K.SVQEIQATFFYFTPN[H7N6S2]KTEDTIFLR.E5,847.496P02763N7250
PE001807R.QDQCIYN[H7N6S2]TTYLNVQR.E4,867.937P02763N93108
PE002206K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6S2]FTTAPAICHDGK.A7,504.273P0DTC2N107410
PE001039K.SVQEIQATFFYFTPN[H7N6S2]KTEDTIFLR.E5,847.496P19652N7250
PE001143R.QNQCFYN[H7N6S2]SSYLNVQR.E4,872.906P19652N9320